Protein Info for EX31_RS19360 in Rahnella sp. WP5

Annotation: isochorismate synthase MenF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00543: isochorismate synthase" amino acids 94 to 433 (340 residues), 351.1 bits, see alignment E=3.6e-109 PF00425: Chorismate_bind" amino acids 175 to 426 (252 residues), 237.3 bits, see alignment E=1.1e-74

Best Hits

Swiss-Prot: 56% identical to MENF_ECOLI: Isochorismate synthase MenF (menF) from Escherichia coli (strain K12)

KEGG orthology group: K02552, menaquinone-specific isochorismate synthase [EC: 5.4.4.2] (inferred from 100% identity to rah:Rahaq_1276)

MetaCyc: 56% identical to isochorismate synthase MenF (Escherichia coli K-12 substr. MG1655)
Isochorismate synthase. [EC: 5.4.4.2]

Predicted SEED Role

"Menaquinone-specific isochorismate synthase (EC 5.4.4.2)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 5.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>EX31_RS19360 isochorismate synthase MenF (Rahnella sp. WP5)
MKQISAIIEQLDTTLAGEWPDAAGIRQFSYSLQKQPDTGLLEWLSAQPCYPKFYWQHRDG
NEEAAVCGDAYSFCDTARAQAFIREHQDEPDLHIWGLNAFNGADGAAIAANALFLPRIEL
CRQGNSYWLRCTVFSPHSLRDEARRTRLFLRSLVVSRALPSIASRVLQHHHLPDEPQWKQ
LIDRALSGIEQHQFDKVVLARKTTLTLSQPLNACAFLAASRDVNHHCYHFMLAFTPQQAF
LGSSPERLFLRDHTELYTEALAGTVANHPDDREARALGDWLLSDGKNQRENLLVVDDICQ
RLQGGAHSLDVTPAEILRLRKVQHLRRNIHGELTDPDDAACLQRLQPTAAVAGLPRQAAR
EFIAEFEPFDREWYAGSAGYLSAEQSEFTVALRSATVKGHHLELYAGAGIVAGSDAAQEW
QEIENKAAGLRTLLEEHYTPAVQAG