Protein Info for EX31_RS19310 in Rahnella sp. WP5

Annotation: ribonucleotide-diphosphate reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00268: Ribonuc_red_sm
  • amino acids 32 to 332 (301 residues), 164.1 bits, E=2.3e-52

Best Hits

Swiss-Prot: 89% identical to RIR2_SALTY: Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 100% identity to rah:Rahaq_1286)

MetaCyc: 89% identical to ribonucleoside-diphosphate reductase 1 subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Protein Sequence (376 amino acids)

>EX31_RS19310 ribonucleotide-diphosphate reductase subunit beta (Rahnella sp. WP5)
MAYSTFSQNKNDQLLEPMFFGQSVNVARFDQQKHEIFEKLIEKQLSFFWRPEEIDVSRDR
IDFQALPDHEKHIFLSNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHS
RSYTHIIRNIVNDPAIVFDDIVTNEEILKRAKDISGYYDTLIEMTSYYHLLGEGTHQVNG
KTVVVNLRELKKKLYICLMSVNALEAVRFYVSFACSFAFAERELMEGNAKIIKMIARDEA
LHLTGTQHALNLLRSGQDDPEMAEIALECQQECHDLFVLAAQQEKDWAEYLFKDGSMIGL
NKDILCQYVEYITNIRMQAVGLDAPFKTRSNPIPWINAWLVSDNVQVAPQEVEVSSYLVG
QIDSEVHADDLSDFEL