Protein Info for EX31_RS18985 in Rahnella sp. WP5

Annotation: glutamine ABC transporter ATP-binding protein GlnQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 165 (149 residues), 135.1 bits, E=4.2e-43
• PF13304: AAA_21
  • amino acids 133 to 194 (62 residues), 30.4 bits, E=6e-11

Best Hits

Swiss-Prot: 90% identical to GLNQ_ECOLI: Glutamine transport ATP-binding protein GlnQ (glnQ) from Escherichia coli (strain K12)

KEGG orthology group: K10038, glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to rah:Rahaq_1354)

MetaCyc: 90% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Protein Sequence (240 amino acids)

>EX31_RS18985 glutamine ABC transporter ATP-binding protein GlnQ (Rahnella sp. WP5)
MIEFKNVSKHFGKTQVLHDIDLNISQGEVVVIIGPSGSGKSTLLRCINKLEEITSGELIV
DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHMTALENVAFGPIRVRGASKDEANKLAKEL
LAKVGLSERANHYPSELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMK
QLAEEGMTMVIVTHEVGFAEKVASRLIFIDKGRIAEDGKPADLVNNPPSERLREFLQHVS