Protein Info for EX31_RS18935 in Rahnella sp. WP5

Annotation: sugar phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 62 to 79 (18 residues), see Phobius details PF11380: Stealth_CR2" amino acids 211 to 313 (103 residues), 133.9 bits, see alignment E=3.8e-43 PF17102: Stealth_CR3" amino acids 363 to 409 (47 residues), 49.9 bits, see alignment 3.6e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>EX31_RS18935 sugar phosphotransferase (Rahnella sp. WP5)
MFRKRAFKGAPPKTKKITSQNNISAFPTINALEVQNLGLVNYLRRNLKAGLGPKDGSDCN
SLLLWAGYLGALINFISGLKSTMTMNITIYTLGGGYSYTSTNGELFDSNQITKNLNSKPD
FVIELSNELGDLYILHFYLFDLDVTGLATVRSNKSWVRKFPLEELENIYSPEKQTKERKI
DAVYTWVNHADLAWQEQWKNSFPDSEFDPDRYTSNDELKYSLRSLNKYAPWLNNIYIVSN
CAKPSWLTNHPRIIWVDHNEIFPYSESLPTFNSHAIESCLHHIKDLSEYFIYLNDDFILG
QPCLPSDFFDEAGRSLAYFEPYGMVYSSSDKEGVPDYLLAAMNSNKLIKEQHPEYDSKYL
HRHVPYALRKSVLMEIERTYPESFSITRNSKIRSPLDINLTSFLYHHYSYINGTSVKSEV
SSLIVRPNNINSILSKDSYKYKILCFNDGNGSADDIAYKKSTQQYLDKRLSEKAPWEVIA
AS