Protein Info for EX31_RS18920 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF01061: ABC2_membrane" amino acids 13 to 219 (207 residues), 54.3 bits, see alignment E=7e-19

Best Hits

Swiss-Prot: 78% identical to KPSM5_ECOLX: Polysialic acid transport protein KpsM (kpsM) from Escherichia coli

KEGG orthology group: K09688, capsular polysaccharide transport system permease protein (inferred from 83% identity to rah:Rahaq_1368)

Predicted SEED Role

"Capsular polysaccharide ABC transporter, permease protein KpsM" in subsystem Capsular Polysaccharide (CPS) of Campylobacter or Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>EX31_RS18920 ABC transporter permease (Rahnella sp. WP5)
MARSGLEVQKAAVKALFLREIKTRFGKYRLGYLWAALEPSAHVLVMLAIFGYIMHRTMPD
ISFPVFLINGIIPFFIFSSISNRSIGAIEANQGLFNYRPVKPIDTIIARAILESIIYAFV
YALLMSAVGLMGEHFKINQLITLVCVWILLVVFSCGIGLIFMVIGKTFPETEKFLPILIK
PLYFISCIMFPLHNVPKDYWHYLLWNPLVHVVELCRTSVFPGYVSEGVSLSYLAFCSLIT
LFIGLALYRTREKAMLTS