Protein Info for EX31_RS18770 in Rahnella sp. WP5

Annotation: molybdopterin-synthase adenylyltransferase MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02355: molybdopterin synthase sulfurylase MoeB
  • amino acids 11 to 250 (240 residues), 417.5 bits, E=7.2e-130
• PF00899: ThiF
  • amino acids 15 to 249 (235 residues), 231.1 bits, E=4.6e-73

Best Hits

Swiss-Prot: 73% identical to MOEB_ECOLI: Molybdopterin-synthase adenylyltransferase (moeB) from Escherichia coli (strain K12)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 98% identity to rah:Rahaq_1399)

MetaCyc: 73% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Protein Sequence (253 amino acids)

>EX31_RS18770 molybdopterin-synthase adenylyltransferase MoeB (Rahnella sp. WP5)
MPQLPELTDAETLRYNRQIILKGFDFDGQEQLKASHALIVGLGGLGCAAAQYLAAAGTGT
LTLLDFDTVSLSNLQRQTLHTDARIGMSKVESAAMALAAINPHIVIHQINAQASDDMLRD
LIAACDVVVDCTDNVTTRNQLNGECFAQKKPLVSGAAIRMEGQLSVFTYQPQEPCYRCLS
RLFGENALTCVEAGVMAPLVGTIGSLQAMETIKLLTKFGETPRGKLLMFDAMTLQFREMK
LMKDPHCEVCGDC