Protein Info for EX31_RS18725 in Rahnella sp. WP5

Annotation: glutathione ABC transporter permease GsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details PF12911: OppC_N" amino acids 28 to 81 (54 residues), 61.1 bits, see alignment E=7.1e-21 PF00528: BPD_transp_1" amino acids 122 to 305 (184 residues), 115.8 bits, see alignment E=2.1e-37

Best Hits

Swiss-Prot: 79% identical to GSID_ECOK1: Glutathione transport system permease protein GsiD (gsiD) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 100% identity to rah:Rahaq_1409)

MetaCyc: 79% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>EX31_RS18725 glutathione ABC transporter permease GsiD (Rahnella sp. WP5)
MKNWRRNAVLAGLPVITPGTVQPQAGRTPWKAFWRRFRRQHIAMIAGVFILLLIAAAILA
PWLVPFDPENYFDYDRLNEGPSLIHWLGVDSLGRDIFSRILMGTRISLTAGVLSVVLGAA
IGTVFGLLAGYYEGWWDRITMRVCDVLFAFPGILLAIAVVAVMGNGMSNVIIAVAIFSIP
AFARLVRGNTLVLKQQTYIESARSIGASDATILFRHILPGTLSSIVVYFTMRIGTSIITA
ASLSFLGMGAQPPTPEWGAMLNEARADMVMAPHVAIFPSLAIFLTVLAFNLLGDGLRDAL
DPKLKN