Protein Info for EX31_RS18695 in Rahnella sp. WP5

Annotation: DUF418 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 10 to 11 (2 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 108 to 123 (16 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details PF04235: DUF418" amino acids 216 to 374 (159 residues), 143.7 bits, see alignment E=2.6e-46

Best Hits

Swiss-Prot: 60% identical to YEIB_ECOLI: Uncharacterized protein YeiB (yeiB) from Escherichia coli (strain K12)

KEGG orthology group: K07148, uncharacterized protein (inferred from 100% identity to rah:Rahaq_1415)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>EX31_RS18695 DUF418 family protein (Rahnella sp. WP5)
MRSRIATLDFARGLAIFGILLLNISAFGLPKAAYLNPAFAGTPSASDTWTWAVLDALAQG
KFLMMFAMLFGGGLFLLLPRGKHWIQARLSILLLCGFLHATLMWDGDILLSYGLIGLVCW
RMVREGRSSQSLISTGIILYLIGVAVLAMLGFITSPKPGSFWLPGPAEIQYEQYWRLKGG
WEAIRNRLDLLSSSLLAIGAQYGWELAGAMLIGSGLMRSGWLKGAFRVSHYRKVAAVLLP
LSLLIQIPAIYLQYRTGWDYRWSGFLLQVPREIGSLMQAVSYLALCYGFWPLISRWRVTH
WISQTGRMALTNYLLQTLICITFFNVFGFYQHFDRLQLVALVPLVWACNVLVTLLWLRHF
RQGPVEWLWRQLTAKAAGEELKAA