Protein Info for EX31_RS18610 in Rahnella sp. WP5

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 235 to 255 (21 residues), see Phobius details amino acids 442 to 464 (23 residues), see Phobius details PF01370: Epimerase" amino acids 10 to 118 (109 residues), 36.5 bits, see alignment E=9.5e-13 PF05368: NmrA" amino acids 10 to 150 (141 residues), 36.9 bits, see alignment E=6.9e-13 PF01073: 3Beta_HSD" amino acids 11 to 118 (108 residues), 31.1 bits, see alignment E=3.2e-11 PF13460: NAD_binding_10" amino acids 14 to 136 (123 residues), 57.3 bits, see alignment E=4.9e-19 PF11066: DUF2867" amino acids 337 to 468 (132 residues), 64 bits, see alignment E=5e-21

Best Hits

Swiss-Prot: 58% identical to YBJT_ECOLI: Putative NAD(P)-binding protein YbjT (ybjT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1433)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>EX31_RS18610 SDR family oxidoreductase (Rahnella sp. WP5)
MPITTHTGRIVVLGASGYIGQHLTAHLSQQGFKVTAAARRIEWLQQQKWPNVRCCFADVY
QSKTLAAAFEGADVLVYLVHAMAEDDDLLEKERQAAQHTLLALKDSSIKHIVYLGSMQPE
DNHSPHLQARKLTGDLLRMSTIPVTELRTGIVIGAGSAAFEVMRDMVYNLPVLTPPRWVR
SKSSPIALENLLNYLQGLVTLPATENQILEAAGPEYISYQTLFKRFIAMSGKRRWLLPVP
LPTSFVSVYFLSLITSVPTSLAKALIQGLNHDLPADSEKLQKLIPQTLIPIDEAIRSTLE
KEQQQIMDSPDWGYDPDARARWCPGYGYYPKQAGFTLETSASKAALWKVIQQLGGAEGYF
YANGLWKTRARIDDLLGGGVKYGRPDRDFLKPGDKIDGWKVIGLKPQRELALLFGMKAPG
LGRLTFTITDHGESRSLDVRAWWHPAGFSGLLYWFSMMPAHQFIFRGMAKRIASLARQKD
RCGR