Protein Info for EX31_RS18285 in Rahnella sp. WP5

Annotation: phage tail tape measure protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 817 transmembrane" amino acids 540 to 560 (21 residues), see Phobius details amino acids 568 to 588 (21 residues), see Phobius details amino acids 594 to 612 (19 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 199 to 548 (350 residues), 302.4 bits, see alignment E=2.1e-94 PF10145: PhageMin_Tail" amino acids 239 to 440 (202 residues), 149.6 bits, see alignment E=5.3e-48

Best Hits

Swiss-Prot: 68% identical to TMP_BPP2: Probable tape measure protein (T) from Escherichia phage P2

KEGG orthology group: None (inferred from 73% identity to rah:Rahaq_0602)

Predicted SEED Role

"corresponds to STY4603 from Accession AL513382: Salmonella typhi CT18"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (817 amino acids)

>EX31_RS18285 phage tail tape measure protein (Rahnella sp. WP5)
MSNNVTLQVLLKAVDQASRPFKSIQTASKSLSQDIRSTQNTIKQLNAQAGQIEGFRKTSA
QLAVTGQSLKNAKQEAAALAIQFKNTTNPTRAQAKAMEEAKRAASDLQLKYNGLRLSVQR
QRQALSEAGISTRSLSESERRLKSSIGETTAQLNRQRDSLARVSAQQARLNAVRQRYQSG
KQLAGSVTAAGARGVGVAAAGTVAGGAALKPGYDFSLKNSELQAVLGLEKDSADMLSLRK
QARQLGDNTAASADDAAAAQIIVAKSGADKDGILAATPTILNLSLANKQSMEDNASLLMG
VKSAFGLANDKVAHIGDVLSTTMNKSAADFAGMSDALTYAAPVAKNAGVSVEQTAAMVGA
LADAKITGSMAGTGSRALITRLQAPTGAAATALDELGVKTADRKGDFRPIFTILKEMQKS
FKKNNLGTAQKAQYMKAIFGEEASSAAAVLMNDASSGKLDALTQALRTSDGKTAELVEIM
QNNLGGDFKEFQSAYEAVGTDIYDQQEASLRSLTQTATKYVLRLDKWIVDNKALATTLAK
IAGGAVMLVGALGVIGLIAGPVIGGINMIVAAAAGLWSALSIAGGAIATVIGGLTWPIVA
IGVAIVAGALLIRKYWEPISAFFSGVIEGLGVAFEPVKELFAPLKPVFDGLGDALKKVWQ
WFKDLIAPVKSTKETLDSCKNAGVIFGQAVANALTAPLQLFNKLRQGVDWLLKKLGLIKD
ESAELDKTADKAEQRSKSDTGDAVPYQPPGGKFGFSYGYVPVAAGGGRNYTDNSKNSYQI
SVGAGTGAQDTGRQVMDALDARERQRRADLRSRLGYD