Protein Info for EX31_RS18265 in Rahnella sp. WP5

Annotation: formate transporter FocA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 70 to 98 (29 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 15 to 276 (262 residues), 262.9 bits, see alignment E=1.3e-82 TIGR04060: formate transporter FocA" amino acids 15 to 279 (265 residues), 424.1 bits, see alignment E=1.9e-131 TIGR00790: formate/nitrite transporter" amino acids 26 to 280 (255 residues), 309 bits, see alignment E=2.2e-96

Best Hits

Swiss-Prot: 83% identical to FOCA_ECO57: Probable formate transporter 1 (focA) from Escherichia coli O157:H7

KEGG orthology group: K06212, formate transporter (inferred from 100% identity to rah:Rahaq_1505)

MetaCyc: 83% identical to formate channel FocA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1; TRANS-RXN-381

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>EX31_RS18265 formate transporter FocA (Rahnella sp. WP5)
MKADNPFDLILPAATAKIAEDAGVYKATKQPLKTFFLAITAGVFISIAFAFYITATTGTG
TVPYGLAKLVGGICFSLGLMLVVVCGADLFTSTVLIVIAKASGRITWGQLACNWVNVYIG
NLVGCLFFVALIWFSGEYMVDNGLWGLNVLQTADHKMHHTFIEAVCLGILANLMVCLAVW
MSYSGRSLMDKMFAMILPVGMFVASGFEHSIANMFMIPLGIVVKNFATPEFWQAVGATPA
QFAELNIPNFIIDNLIPVTIGNIIGGGLLVGLTYWVIYLRDEKHH