Protein Info for EX31_RS18070 in Rahnella sp. WP5

Annotation: membrane integrity-associated transporter subunit PqiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 53 to 72 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 257 to 282 (26 residues), see Phobius details amino acids 303 to 329 (27 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 6 to 409 (404 residues), 507.5 bits, see alignment E=1.5e-156 PF04403: PqiA" amino acids 51 to 201 (151 residues), 125.1 bits, see alignment E=1.2e-40 amino acids 254 to 409 (156 residues), 182.8 bits, see alignment E=2.1e-58

Best Hits

Swiss-Prot: 69% identical to PQIA_SHIFL: Intermembrane transport protein PqiA (pqiA) from Shigella flexneri

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 100% identity to rah:Rahaq_1544)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>EX31_RS18070 membrane integrity-associated transporter subunit PqiA (Rahnella sp. WP5)
MCSDAHDHDPHILCPQCDMLVAIPGLHIGQKAVCPRCHTTLTSRWNEPRRRPVGYAISAL
FMLLLANLFPFVNMNVAGLSSEVTLVQIPQVLVSEDYASMASLFMIVVQLLPAICMLSII
ILCQSFNIPVRWKVVIARTLFQLKAWCMVEIFLAGVLVSFVKLMAYGDVGVGSSFYPYVL
FCLLQLRAFQCTDRLWIWQHIEPAPAVDQPLRMGESGLRQGLRSCHCCMAILPVDQKECG
RCKTHGHARRKNSLQWTMALLVTSVLLYIPANLLPIMITQVLGNPIPSTIMAGVALLWSE
GSYPVALVILIASIMVPTLKMIAIGWLCWDANSNKEIDRERLHVIYEVVEFVGRWSMIDV
FVIAVLAALVRMGQLMSIYPDIGALLFAGVVILTMFAATTFDPRLIWDRAGMKSTKEPQD
GGK