Protein Info for EX31_RS18025 in Rahnella sp. WP5

Annotation: TIGR01666 family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 415 to 431 (17 residues), see Phobius details amino acids 438 to 459 (22 residues), see Phobius details amino acids 465 to 482 (18 residues), see Phobius details amino acids 487 to 506 (20 residues), see Phobius details amino acids 509 to 510 (2 residues), see Phobius details amino acids 512 to 532 (21 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 10 to 705 (696 residues), 938.8 bits, see alignment E=1.8e-286 TIGR01666: TIGR01666 family membrane protein" amino acids 10 to 705 (696 residues), 1026.9 bits, see alignment E=0 PF12805: FUSC-like" amino acids 68 to 346 (279 residues), 356.1 bits, see alignment E=2.4e-110 PF04632: FUSC" amino acids 166 to 502 (337 residues), 35.1 bits, see alignment E=1.3e-12 PF11744: ALMT" amino acids 398 to 594 (197 residues), 23.6 bits, see alignment E=4.6e-09 PF13515: FUSC_2" amino acids 405 to 525 (121 residues), 96.4 bits, see alignment E=3e-31

Best Hits

Swiss-Prot: 69% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1554)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>EX31_RS18025 TIGR01666 family membrane protein (Rahnella sp. WP5)
MLSIAPGLRRYAYNSNILYHIRIFIALTGAAALPWWLGQFTLTIPLTLGVVAAALADLDD
RLAGRLRNLLITLVCFFIASASIELLFPYPWLFAPGLMISTCGFILLGALGQRYATIAFG
ALLIAIYTMLGTSMYHIWYQQPLILLAGAIWYNLLTLAGHIIFPIRPLQDQISRCFTQLA
AYLEAKATLFDPDQDDNNQQLVELAMANGQLVSTLNQTKNTLQTRLKGDRGQKGTRRTLH
YYFVVQDIHERASSSHVQYLKLSEQFHHSDILFRFQRLMSMQARACLQLSQCILYRQQYT
HNSQFERAFSRLEEALKRLESHHEHRETLQALRHLLRNLHAIDAQLANIESEQSLPENQT
GKSPFAEDRLTGLDDIWLRISRHFTPQSVLFRHAIRMSVVLFVGYVFIQVSGLNHGYWIL
LTSLFVCQPNYSATRRRLALRIIGTLAGIALGIPILYFVPSVDGQMILIVISGLLFFAFR
TVQYAQATMFITLLVLLCFNLLGEGFEVAIPRVIDTLIGCGIAWAAVTFIWPDWKFRQLD
KVVRKTFDANCRYLDAILVQYHQGKDNSLEYRLARRDAHNCDAELASVVSNMSSERNNEP
STLEAAFRLLCLNHTMLSYISALGAHREKLNDAETLRLLDDAACCVDGALHHLPSEAERI
QHALGELTARIQMRTTDIDSKEQLVLQQIGLLVAHLPELTSLNTKILPAQNRL