Protein Info for EX31_RS17900 in Rahnella sp. WP5

Annotation: gamma-glutamyl-gamma-aminobutyrate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 18 to 235 (218 residues), 213.2 bits, E=4.2e-67
• PF00117: GATase
  • amino acids 87 to 251 (165 residues), 44.6 bits, E=1.4e-15

Best Hits

Swiss-Prot: 60% identical to PUUD_ECOLI: Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD (puuD) from Escherichia coli (strain K12)

KEGG orthology group: K09473, gamma-glutamyl-gamma-aminobutyrate hydrolase [EC: 3.5.1.94] (inferred from 99% identity to rah:Rahaq_1577)

MetaCyc: 60% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (10/13 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (8/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Protein Sequence (267 amino acids)

>EX31_RS17900 gamma-glutamyl-gamma-aminobutyrate hydrolase (Rahnella sp. WP5)
MGNIFSTASAGKETRYRPVIGVVMCKNIVDENPALTVHEKYLDAIFNADALPVCLPHELA
AREGAIDQILRGLDGIFLTGSPSNIEPHQYGEEGVEEQADPGRDRLSLQLIRATLDKKIP
LFAACRGLQELVVATGGSLHRKVQDVPGYMDHREDTTLPHDNQYDLVHPVHIEPGGLLSE
LLPDYQQFQVNSLHGQGANRLGDALTVEARAPDNLVEAVSVRNHPFALGVQWHPEWHSLT
DPVSRQLFNAFIAACRKGHQARSAREE