Protein Info for EX31_RS17790 in Rahnella sp. WP5

Annotation: citrate lyase acyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 TIGR01608: citrate lyase acyl carrier protein" amino acids 1 to 92 (92 residues), 108.1 bits, see alignment E=1.4e-35 PF06857: ACP" amino acids 5 to 84 (80 residues), 99 bits, see alignment E=7.7e-33

Best Hits

Swiss-Prot: 73% identical to CITD_PECCP: Citrate lyase acyl carrier protein (citD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01646, citrate lyase subunit gamma [EC: 4.1.3.6] (inferred from 100% identity to rah:Rahaq_1600)

MetaCyc: 50% identical to citrate lyase gamma subunit (Klebsiella pneumoniae)

Predicted SEED Role

"Citrate lyase gamma chain, acyl carrier protein (EC 4.1.3.6)" in subsystem TCA Cycle (EC 4.1.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.6

Use Curated BLAST to search for 4.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>EX31_RS17790 citrate lyase acyl carrier protein (Rahnella sp. WP5)
MKIVKEALAGTVESSDLLVKIAPASELNVVISSEVAKQFGDQIRSVVNDTLSALGVIAGL
VIIEDKGALDCVIRARVQSAVLRAAQAEEINWETLR