Protein Info for EX31_RS17785 in Rahnella sp. WP5

Annotation: [citrate (pro-3S)-lyase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR00124: [citrate (pro-3S)-lyase] ligase" amino acids 21 to 342 (322 residues), 394.4 bits, see alignment E=3.8e-122 PF08218: Citrate_ly_lig" amino acids 151 to 338 (188 residues), 240.7 bits, see alignment E=1.4e-75 TIGR00125: cytidyltransferase-like domain" amino acids 151 to 209 (59 residues), 40.4 bits, see alignment E=2.7e-14 PF01467: CTP_transf_like" amino acids 159 to 241 (83 residues), 25 bits, see alignment E=3e-09

Best Hits

Swiss-Prot: 48% identical to CITC_ECOLI: [Citrate [pro-3S]-lyase] ligase (citC) from Escherichia coli (strain K12)

KEGG orthology group: K01910, [citrate (pro-3S)-lyase] ligase [EC: 6.2.1.22] (inferred from 100% identity to rah:Rahaq_1601)

MetaCyc: 48% identical to [citrate [pro-3S]-lyase] ligase (Klebsiella pneumoniae)
[Citrate (pro-3S)-lyase] ligase. [EC: 6.2.1.22]

Predicted SEED Role

"[Citrate [pro-3S]-lyase] ligase (EC 6.2.1.22)" (EC 6.2.1.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>EX31_RS17785 [citrate (pro-3S)-lyase] ligase (Rahnella sp. WP5)
MFSRDQPDFHVISVSQPPEGMLEDIRTLLQQSQLGMDDDIEQFVVACSGRRLVGCAGLVS
NTIKCVAVAADWRGENLSARLLGEVENLAVSGGKFHLFLYTRPSNLQRFRGCGFYPLVQW
DDVAVLMENTPVGISHYCRGLQRHHHSGQRIGAVVMNANPFTLGHRFLAEQAAATCDWLH
VFVVSEDVSYFPFKERLEMVRLGVADLPNVTVHAGSEYLISRATFPGYFLKDAGLVNQAW
SVMDLLIFRQYIAPALGITHRFVGSEPFCPVTHQYNCDMHDWLEAPARLTSPPLKVIELP
RKRHASGRAISASEVRALLRAHQLPRIRDIVPLSTYVHLEQHYSATAPAEPAHDDVLIIS
PSLC