Protein Info for EX31_RS17770 in Rahnella sp. WP5

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 36 to 163 (128 residues), 61.1 bits, see alignment E=2e-20 PF14501: HATPase_c_5" amino acids 421 to 514 (94 residues), 36.9 bits, see alignment E=4.4e-13 PF02518: HATPase_c" amino acids 422 to 529 (108 residues), 71.8 bits, see alignment E=9.8e-24

Best Hits

Swiss-Prot: 44% identical to CITA_KLEPN: Sensor histidine kinase CitA (citA) from Klebsiella pneumoniae

KEGG orthology group: K07700, two-component system, CitB family, cit operon sensor histidine kinase CitA [EC: 2.7.13.3] (inferred from 100% identity to rah:Rahaq_1604)

Predicted SEED Role

"Sensor kinase CitA, DpiB (EC 2.7.3.-)" in subsystem Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>EX31_RS17770 sensor histidine kinase (Rahnella sp. WP5)
MRFRPSFQIKLFVYLVVLFMALFSLTGVYYYHDIERQLYEDMGIRAKVQAEEIALIPSLI
TAVENKDISAINSLMRNISAHSDASYMVIGDGKAIHLFHSIYADRVGKTLVGGDNEEVLA
GKSTTTIRLGGIGLSLRSKAPIVNAQGKVMGIVSVGYLTSHINSLTVEKAIRILLAAATL
LLALFTFSWFFSRSIKRQMFALEPREIGLLVRQQKALMESIYEGVIAIDAHSRVAVINQA
AKKLLNLDVPSRELRGQPLRQVIAPVSFFDPQVMLKKDIHDEICLFNNLTVIASRVRIML
EDQLQGWVITFRDCSDIDRLSIQLSQVQRYADNLRVMRHEQLNWTATLAGLLHMGRYDEA
IRYIEAQSESAQELLDFVSERFCSPRLCGLLLGKYARAREKGVELTFDPACELTYLPAAL
SETELMSIIGNLLDNAIEATLLRGSDAGPVEVYVVSGTDELVIEVADHGIGIAQERREQI
FALGVTSKTQGDHGLGLHLVASYVSHAGGTIEVSDNPPSGAVFSVFIPVCCPEEKGGFMP
VIPDQKNWKRANDAS