Protein Info for EX31_RS17750 in Rahnella sp. WP5

Annotation: glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF02798: GST_N" amino acids 3 to 75 (73 residues), 52.9 bits, see alignment E=1.1e-17 PF13417: GST_N_3" amino acids 8 to 79 (72 residues), 39.1 bits, see alignment E=2.2e-13 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 46.2 bits, see alignment E=1.7e-15 PF00043: GST_C" amino acids 111 to 197 (87 residues), 39.5 bits, see alignment E=1.6e-13 PF14497: GST_C_3" amino acids 116 to 202 (87 residues), 25.9 bits, see alignment E=2.9e-09 PF13410: GST_C_2" amino acids 128 to 191 (64 residues), 25.5 bits, see alignment E=3.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1608)

Predicted SEED Role

"Uncharacterized glutathione S-transferase-like protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>EX31_RS17750 glutathione S-transferase family protein (Rahnella sp. WP5)
MIRVWGRKTSSNVQALMWCIGELGLEYERFDIGHKYGGNDTPEFLAMNPNGTVPVIRDGE
GQPLWETGAILRYLAGKYGADEFWPQDPERRAETDKWTEWAKISVAMNFTAPVFWMVVRT
AAKDQDHQALEKSLQNLNKKLAIAEAQIARHGYLAGSAFTLADIQFGHSLYRYFDIAIER
PSFPAIEHYYEKLTQRPAFAEHVMISYEELRVV