Protein Info for EX31_RS17735 in Rahnella sp. WP5

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00356: LacI" amino acids 3 to 48 (46 residues), 56.6 bits, see alignment 2.7e-19 PF00532: Peripla_BP_1" amino acids 62 to 314 (253 residues), 170.5 bits, see alignment E=8.3e-54 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 71.4 bits, see alignment E=1.5e-23

Best Hits

Swiss-Prot: 55% identical to CSCR_SHIFL: Sucrose operon repressor (cscR) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1613)

Predicted SEED Role

"Sucrose specific transcriptional regulator CscR, LacI family" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>EX31_RS17735 LacI family DNA-binding transcriptional regulator (Rahnella sp. WP5)
MASLKDVAKLANVSLMTVSRALNSPERLKPETLARVQSAIDATNYVPDLSAKKIRGAHAI
AKTIGVLALDTVTTPFSVEITLSIEETARAHGWNSFVVNMFSDDSPEKIVDLLLSHRPDG
IIYTTMGLRQVPLPGKLLNLPCVLANCESLHQQVASYIPDDEHGQYVAVRALLSAGYRRP
LCLHLPANHLATVRRRKGLEQACTQAGIDPDTLDHHYMEYGDEHYHDIPDMLLAHINQGK
PQFDSVVCGNDRIAFMVYQTLLSQGLRIPDDVAVLGYDNMVGIGDLFLPPLSTVQLPHYE
IGRLSALHIINGECHKNTVAVESPLLLRESVKKPQ