Protein Info for EX31_RS17555 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 31 to 182 (152 residues), 124.9 bits, E=1.9e-40

Best Hits

Swiss-Prot: 44% identical to OPPF_LACLS: Oligopeptide transport ATP-binding protein OppF (oppF) from Lactococcus lactis subsp. cremoris (strain SK11)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to rah:Rahaq_1655)

MetaCyc: 45% identical to nickel ABC transporter ATP binding subunit NikE (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Protein Sequence (261 amino acids)

>EX31_RS17555 ABC transporter ATP-binding protein (Rahnella sp. WP5)
MSNVIEVNGLVKTFGSTSGWFSGRKLQVEAVKGISLHLAEGETLAVVGESGSGKSTLARM
LVGLERPTSGTIKLMGEAMSTHAKRSDKAFGQMIQYVFQDPVASLNPRKTIADTLDVPLR
YLCAYPTMRRKARMLELMEAVQMPADALSGYPHEFSGGQAQRLAIARALAAEARILVLDE
PVSALDVSVQAQVLLLLDRLKREFGLSYLFISHDLAVVESIADRVAVMYHGDLVECADND
RLFNAPQHAYTQRLLASAPRV