Protein Info for EX31_RS17450 in Rahnella sp. WP5

Annotation: ATP-independent periplasmic protein-refolding chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13801: Metal_resist" amino acids 27 to 117 (91 residues), 41 bits, see alignment E=2.1e-14 PF07813: LTXXQ" amino acids 51 to 144 (94 residues), 57 bits, see alignment E=3e-19

Best Hits

Swiss-Prot: 42% identical to SPY_ECO57: Periplasmic chaperone Spy (spy) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_1677)

Predicted SEED Role

"Periplasmic protein related to spheroblast formation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>EX31_RS17450 ATP-independent periplasmic protein-refolding chaperone (Rahnella sp. WP5)
MRKLTAMIVASTLALSSASFAFAAETAATPATDATTATHGKMLHHKGPQHMNPFAALNLT
EQQKTQMKEIMKDSGARPDRAAMKAQMDQMHNLVASDSFDEAKVKSQIDTITKAQSDRML
DRARAENKMYNLLTPEQKKQFNENYQNRAAKMEQMRDHKPGQEKPVTAE