Protein Info for EX31_RS17330 in Rahnella sp. WP5

Annotation: Gfo/Idh/MocA family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 4 to 121 (118 residues), 101.1 bits, see alignment E=6.8e-33 PF21378: YceM-like_C" amino acids 127 to 245 (119 residues), 169.7 bits, see alignment E=3e-54

Best Hits

Swiss-Prot: 62% identical to YCEM_ECOLI: Putative oxidoreductase YceM (yceM) from Escherichia coli (strain K12)

KEGG orthology group: K03810, virulence factor (inferred from 100% identity to rah:Rahaq_1699)

Predicted SEED Role

"Virulence factor MviM" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>EX31_RS17330 Gfo/Idh/MocA family oxidoreductase (Rahnella sp. WP5)
MSKLRIGVIGLGGIAQKAYLPVLSHAENWTLVGGFSPNQQKAQAICDSYRMACFSRMDEL
AGQCDAVFVHSSTASHFEVVGQLLAQGVHVYVDKPLAAELEQAEQLVEQARKTGKTLMVG
FNRRFAPLYRQLKDNMQSAASLRMDKHRTDSVGPNDLRFTLLDDYLHVVDTALWLAGGNA
SLESGLIQINEANQMLYGEHHFLCGETLVTTSMHRRAGTFRESVQAVTEGAVYQLDNMQI
WREEQQDILTQLPVPGWQSTLTQRGFVGAIEHFVACASNQTAPETSGEQAIYAQAMIEKI
LNS