Protein Info for EX31_RS17080 in Rahnella sp. WP5

Annotation: FTR1 family iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 376 to 403 (28 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details amino acids 486 to 503 (18 residues), see Phobius details amino acids 523 to 547 (25 residues), see Phobius details amino acids 559 to 580 (22 residues), see Phobius details amino acids 610 to 628 (19 residues), see Phobius details PF03239: FTR1" amino acids 202 to 503 (302 residues), 162.1 bits, see alignment E=9e-52 amino acids 497 to 584 (88 residues), 29 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 76% identity to pct:PC1_1385)

Predicted SEED Role

"Putative high-affinity iron permease" in subsystem Campylobacter Iron Metabolism or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>EX31_RS17080 FTR1 family iron permease (Rahnella sp. WP5)
MSLWQRILFLCSCLLISTLTFGAPTDYQQWITDIQQRLDKTSKLYQQKQTDEARTQVQMA
YFEVFENLEGPIRINISSQKSYQMEATFGEIRRMIGEGKPLPEVQARIDWLKGELDGVLP
VLADGHRVEAQQQHGAYGNSNIAPYWQQSFKVIDDLLAQAVTDYQDGKFQQAGKIVQLAH
YEGFKNSEMEMSVRVNRSSQQAAAINQQFSALIALASTPDNMSDVAYRVTTLIQDIEEQL
PGLPTTREQQQTVPDQAANGPADGGTDADWKHVSAQIEQAISAALDHYKQGQSKPAMMAV
QDAYFDLFEASGMENKLGSRDAAFKSTLEGYFTRMVSMIKAGQPLDQLQEQASALQQDLD
KAVTMLGEGNETHWSLLIYSLLIILREGLEALLIVAAIVAYLVKNNHQDKLPLIRQSVYA
ALLASVVTAFIFQWLFSNSGASRELLEGVTMLIAVVMLFSMSYWLLSKVEARHWKAYLEG
KLSHSLSSGSMAGLWLTSFLAVYREGAETVLFYLALIGDASSVGGHLSILGGFAAGCVLL
LLAWLVMRYSVVRLPLKPFFMFTGGFMYLMAFVFAGKGVLELIEGKLFEPTLLQGVPEIS
GLGIYPYVETLLPQGVLLLAAVLALWVMRRQSLNADRKTNIA