Protein Info for EX31_RS17020 in Rahnella sp. WP5

Annotation: aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 16 to 387 (372 residues), 342.2 bits, E=2.9e-106
• PF00155: Aminotran_1_2
  • amino acids 67 to 279 (213 residues), 27.1 bits, E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2124)

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-methionine biosynthesis I (5/5 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48

Protein Sequence (392 amino acids)

>EX31_RS17020 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme (Rahnella sp. WP5)
MQQDDKSQPVELGENTRLVHDARHDRGAISPPIYQSSLFSFTDYDSMIARFRGDSDHALY
SRVDNPTVVELQKKVAQLEGGEACLAFGSGMAAISNAILSVAGPGDKVVCVNHVYPDTYR
FLRGFCTRFQIESQFVDGGSLPALEEAMQGAKLLYLESPNSWVMGEQNLRAIAELAKKYG
VITMIDNSWASPIFQKPLAAGIDLVIHSASKYISGHSDVVAGLVISSQERISAISRYISP
FLGGKLSANEAWLLLRGLRTLPLRMRQHHESALELARRLQGYSRITQVNHPGLDPLPTST
LTGYSGLFSFELSEGIDIPTFCNALNLFRMGVSWGGFESLVMPAISVLNQAGEFNSAIDF
GVSPRVIRISIGLEETEDLWRDLKNAIESACS