Protein Info for EX31_RS17010 in Rahnella sp. WP5

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 26 to 52 (27 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 300 (201 residues), 69.6 bits, see alignment E=1.5e-23

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to rah:Rahaq_2126)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>EX31_RS17010 sugar ABC transporter permease (Rahnella sp. WP5)
MMLEVSPPDTAAVPRFPRLRALLEPWVYLSPTLVLIGLFIFVPMAIGISYAFQNIQLLNP
FDTGWVGLDNFRTMFDDRHFYAALRHTFNWTLTSLVLQFALGLGLALLLNREFPGRRWVQ
ALVFLPWAVPAFLSGLTWAWLLNPVIGVLPYWLADLHIISEPYNILSDPQLALYGPVVAN
VWFGIPFFAITLLAALQSIPKDLYEAAAMDGATGWQQFRKVTLPFLAPMIAITVMLRTIW
IANFADLIVVMTDGGPANSTSILSSFIFTTAYRKLDFGYASAMAVFLLVLMTLYALVLLR
IRHQLLK