Protein Info for EX31_RS17005 in Rahnella sp. WP5

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 273 (183 residues), 68 bits, see alignment E=4.7e-23

Best Hits

Swiss-Prot: 35% identical to MALG_THELN: Trehalose/maltose transport system permease protein MalG (malG) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to rah:Rahaq_2127)

MetaCyc: 34% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>EX31_RS17005 carbohydrate ABC transporter permease (Rahnella sp. WP5)
MNALSFNAWLRKGGHRLGILFYLVFALFPIYWLIKISVTPDKLLYSEGVRMWPGEMTLTH
FQRVFTESQFPLYFFNSLIVSFGTAFLTTIIAAGAGFAFSRFSFRGKTVMAALLLFTQMF
PLVMILAPIYKVMAPLGLTNSLLGLVLIYTAFNVPFATFLMQSFFDSIPKDLEESAMLEG
CSRFMALRKVIIPLTLPGMAATLGFVFTAAWSELLFSLMLINKNEVMTFPVGLLSFVSKF
AVSWGDMMAAAVLALIPACLFFAFIQRYLVQGLTAGAVKG