Protein Info for EX31_RS16910 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details amino acids 374 to 391 (18 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 359 (326 residues), 86.6 bits, see alignment E=7.9e-29

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 47% identity to spe:Spro_3850)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>EX31_RS16910 MFS transporter (Rahnella sp. WP5)
MSVISDKTPHVKKSLFSLTFIGILLIASNLRAPITALGPVIHQIAASFNLSGTYTGLLDA
LPLLIFGLASPFAPVLTRRIGLESSLLAALVLITVGCLVRSSLGVVGLWTGTFIIGLGIA
VANVLVVPLIKRDYPVHAARCIGFYAATMALTAALSSGMASPLSALSSATWRVSMGIWVI
PAVFALIVWIKVCARMGNEVGSTKKPVIQGTSSVWKSGVAWQVSMFMALQTMAFYTLIDW
YPSMANTHGVSSSVAGFHLFIYQAVAVLANLSTAVFIARLRDQRLLGLICSLFITSGVAG
LLLMPAVSVLWLILAGIGAGMSMVTCLTLFGLRAREHHQAGQLSGKAQCIGYLIGALGPC
LAGILHGYTHTWNSTLLCLLLVSFAQAYFAWQAGRNRLV