Protein Info for EX31_RS16885 in Rahnella sp. WP5

Annotation: sugar phosphate isomerase/epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF01261: AP_endonuc_2" amino acids 29 to 321 (293 residues), 133.2 bits, see alignment E=7e-43

Best Hits

KEGG orthology group: None (inferred from 79% identity to pva:Pvag_pPag30253)

Predicted SEED Role

"Inosose isomerase (EC 5.3.99.-)" in subsystem Inositol catabolism (EC 5.3.99.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>EX31_RS16885 sugar phosphate isomerase/epimerase (Rahnella sp. WP5)
MKTLKGPGIFLSQFIGQQTPFNTLDGLAQWASALGYKALQIPCNHPLIFDLERAATSQTY
CDEVTGVLASYGLVVSELSTHLEGQLIAVHPAHDLAFDSFAPAQVRGDNAKRTAWAINTV
KLAAAASAKLGLSAHATFSGSLAWPYLYPWPPHNPALLEEAFEELARRWQPVLDEFDSHG
VDVCYEIHPGEDLHDGVTFERFLAQVNNHPRCNILFDPSHLHLQHMDYLQFIDIYHSRIK
AFHVKDAEYLPNGRSGVYGGYQRWLDRAGRFRSPGDGQIDFKGIFSKLAQYDYGGWAVLE
WECCLKDSETGAREGAEFIQRHIIPVADRAFDDFAAQDGDHASVHAQLGLDRGA