Protein Info for EX31_RS16665 in Rahnella sp. WP5

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF00892: EamA" amino acids 9 to 142 (134 residues), 48.9 bits, see alignment E=3.8e-17 amino acids 161 to 295 (135 residues), 76 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_2358)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>EX31_RS16665 EamA family transporter (Rahnella sp. WP5)
MTITPRERMTGVLAVVFASVLWGSTGTAATFAPDVSPLAIGAVAMGLGGLLQALISARRI
VTSRVTLVNNARMLFTGALAVAVYPLAFYASMHLAGVTVGTVISLGSAPLLSALIEYYLD
GQRLTRRWMTGAAIGVAGMVLLCVGESGSHSTAGQGDHAIAGVVLGLIAGLTYALYAWAA
RHLMQRGVPSRAAMGATFGLGGLLLMPVLWVTGAPLLASWNNAAVGAYMALIPMFVGYVC
FGYALARIPASMATTITLLEPAVAAVLAVVIVGERLPPLGWTGIGLAVACLIFITVPLKR
RVTLPVSA