Protein Info for EX31_RS16375 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details PF05977: MFS_3" amino acids 17 to 395 (379 residues), 61.2 bits, see alignment E=7e-21 PF07690: MFS_1" amino acids 36 to 361 (326 residues), 78.9 bits, see alignment E=3.6e-26

Best Hits

KEGG orthology group: None (inferred from 45% identity to gan:UMN179_00601)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>EX31_RS16375 MFS transporter (Rahnella sp. WP5)
MKAKINKNYLALSSSLAISKTGDYAHEVVFALIVIELLRENYLLIGVVYFFRFVPFIFFG
PIGGWLADRYPLKNTMIYSELLRLVASVLLLLLYEYDALNLVSMIACTLVITVGRSIFQP
SFQSCVPKLFRENTLIRINSSFQMIDQVASIAGPLLCSMLILSVGKQGVLIFDSLTYVVS
MVALLMLTQAKMEGSLRPAFSVASIFKDTWDNVQFLRWHSRDLFASIIGSALCILFTASL
LRYVLPAFVIFKGGTEVEVSYIFAALASGTVVGSLLYAKFSVIRSPSALMKWWMAYGAVF
ILLACTINLSITLSYGISFVLGGCGAFVDISIVSLIQALSGKQDIGKNFGLFSTLANTGE
AASGLIYGFFALAGIFASFIMMASLISISAMLMLRNMGRGESLK