Protein Info for EX31_RS16330 in Rahnella sp. WP5

Annotation: endoribonuclease MazF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF02452: PemK_toxin" amino acids 9 to 106 (98 residues), 85.6 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 72% identical to MAZF_ECO57: Endoribonuclease MazF (mazF) from Escherichia coli O157:H7

KEGG orthology group: K07171, (no description) (inferred from 86% identity to ebi:EbC_pEb17201460)

MetaCyc: 72% identical to endoribonuclease toxin MazF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Programmed cell death toxin MazF" in subsystem MazEF toxin-antitoxing (programmed cell death) system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>EX31_RS16330 endoribonuclease MazF (Rahnella sp. WP5)
MVSRFVPDSGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQVKNYPF
EVELSGSREGVALADQVTCVDWRARKITKKGTVAVNELAEIRAKAKSLIG