Protein Info for EX31_RS16190 in Rahnella sp. WP5

Annotation: type II secretion system minor pseudopilin GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details PF07963: N_methyl" amino acids 10 to 35 (26 residues), 29.9 bits, see alignment 2.8e-11 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 12 to 35 (24 residues), 23.9 bits, see alignment 2.7e-09 TIGR01707: type II secretion system protein I" amino acids 14 to 106 (93 residues), 64.7 bits, see alignment E=9.4e-22 PF02501: T2SSI" amino acids 50 to 121 (72 residues), 36.2 bits, see alignment E=5.3e-13

Best Hits

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 98% identity to rah:Rahaq_0332)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>EX31_RS16190 type II secretion system minor pseudopilin GspI (Rahnella sp. WP5)
MRISSTCSVKNQQGMTLIEVIIALGIFATAALALLNSLGSQMSAVDHFRTSLFASWVAEN
TLIETQIKAEKKEKRRVTLAGQEWFVEQQHTLDRENNISQNQVRVLQVEDALSPILSVSR
WTQIMAEKP