Protein Info for EX31_RS16180 in Rahnella sp. WP5

Annotation: type II secretion system major pseudopilin GspG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF07963: N_methyl" amino acids 14 to 37 (24 residues), 39.7 bits, see alignment 2.4e-14 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 15 to 38 (24 residues), 35.8 bits, see alignment 4.6e-13 TIGR01710: type II secretion system protein G" amino acids 16 to 146 (131 residues), 176.5 bits, see alignment E=2.6e-56 PF08334: T2SSG" amino acids 40 to 146 (107 residues), 125.9 bits, see alignment E=7.2e-41

Best Hits

Swiss-Prot: 76% identical to GSPG_ECOLI: Putative type II secretion system protein G (gspG) from Escherichia coli (strain K12)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 99% identity to rah:Rahaq_0334)

MetaCyc: 76% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>EX31_RS16180 type II secretion system major pseudopilin GspG (Rahnella sp. WP5)
MLNIQKNQYIGTQRQQGFTLIELMVVIVILGVLAALVVPNVMGNKERADTQKAVSDIVAL
ENALDMYKLDNHRYPTTEQTLEALVTLPTINPLPANYRNDGYIKRLPADPWGNEYMLVSP
GEHGAIDVFSAGPDSEPNTADDIKNWVEKDH