Protein Info for EX31_RS16175 in Rahnella sp. WP5

Annotation: type II secretion system inner membrane protein GspF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 170 to 197 (28 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 255 to 269 (15 residues), see Phobius details amino acids 370 to 395 (26 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 404 (401 residues), 478.1 bits, see alignment E=1.4e-147 PF00482: T2SSF" amino acids 71 to 194 (124 residues), 115.1 bits, see alignment E=1e-37 amino acids 275 to 395 (121 residues), 87.8 bits, see alignment E=3e-29

Best Hits

Swiss-Prot: 58% identical to GSPF_ECOLI: Putative type II secretion system protein F (gspF) from Escherichia coli (strain K12)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 100% identity to rah:Rahaq_0335)

MetaCyc: 58% identical to type II secretion system protein GspF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>EX31_RS16175 type II secretion system inner membrane protein GspF (Rahnella sp. WP5)
MSRFAFHAITPTGKTQRGVIDADSLRLARQIVRERGLTLLEIKQVGNSLTTLNSKNKGLK
TRVPSHAISLFSRQLATLTNAALPVEAALAVIARQTEHAGLTQVLTAVRNKVVEGHTLAD
ALSDFPRLFDPMFRTLVTAGERTGQLGTVLEKMADYYEIRQQIKSKLSQAMIYPAMLTII
AILVIVILLVAVVPQIIEQFVHMKHTLPISTRILIGVSGFLERTWWVIAIVVIAFIATFR
LALRRKHNLMRFHTALLGVVVLGPLIRAINSARYARTLSILQSSGVPLLDAMKISTEGIT
NRRIHYLLTQAAEHVRQGSSLFAVLEQTRLFPPMMLYMIASGEQSGRLGELMAHAADNQD
KLMQHRLSMVLALFEPLLIVTMASIVLFIIMSILQPILQLNNMVS