Protein Info for EX31_RS15995 in Rahnella sp. WP5

Annotation: large-conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00220: large conductance mechanosensitive channel protein
  • amino acids 3 to 133 (131 residues), 182.2 bits, E=2.1e-58
• PF01741: MscL
  • amino acids 3 to 131 (129 residues), 158.1 bits, E=6.3e-51

Best Hits

Swiss-Prot: 85% identical to MSCL_SERP5: Large-conductance mechanosensitive channel (mscL) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 99% identity to rah:Rahaq_0372)

MetaCyc: 79% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Protein Sequence (138 amino acids)

>EX31_RS15995 large-conductance mechanosensitive channel protein MscL (Rahnella sp. WP5)
MSFMKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSFVADIIMPPLGLLIGGVDFKQFAFV
LREAQGAAPAVVMHYGVFIQNVFDFIIVALAIFCAITLMNKMRRKQEDKPAAPPKPTAEE
ALLAEIRDLLKEQQAPKL