Protein Info for EX31_RS15855 in Rahnella sp. WP5

Annotation: virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 30 to 60 (31 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 133 to 162 (30 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 239 to 269 (31 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 16 to 274 (259 residues), 295.7 bits, see alignment E=1.9e-92 PF03631: Virul_fac_BrkB" amino acids 26 to 273 (248 residues), 209.6 bits, see alignment E=3.4e-66

Best Hits

Swiss-Prot: 76% identical to Y4878_SERP5: UPF0761 membrane protein Spro_4878 (Spro_4878) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to rah:Rahaq_4380)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>EX31_RS15855 virulence factor BrkB family protein (Rahnella sp. WP5)
MQKRALSHYLKSLWKFTRLLLKRSDKDGLTLLAGHLAYVSLLSLVPLIAVVFSLFALFPV
FSEISMQLKTFIFSNFMPATGNTIQRYLEQFVANSSKMTAVGTCGLIVTALLLIASVDSV
LNKIWDSKTTRPIVFSFAVYWMVLTLGPILLVASVAVSSYLLSLNWLNISGVHSVIDHAL
RILPLLISWVTFWLLYQVVPTVRVPAKDALIGALVSGVLFELSKKIFTLYIQLFPSYQLI
YGVLAVIPILFLWVYVSWCIVLLGAEITVTLGEYRSLRKLQSAQHRAEE