Protein Info for EX31_RS15790 in Rahnella sp. WP5

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 5 to 78 (74 residues), 75.3 bits, see alignment E=1.4e-25 amino acids 91 to 164 (74 residues), 77.6 bits, see alignment E=2.7e-26

Best Hits

Swiss-Prot: 75% identical to YICG_ECOLI: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4367)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>EX31_RS15790 trimeric intracellular cation channel family protein (Rahnella sp. WP5)
MLLTVLYIIGITAEAMTGALAAGRRKMDSFGVIIIAAATAIGGGSVRDMLLGHYPLGWVK
HPEYIVIVAVAALMTTWLAPLMQHLRKLFLVLDAVGLVVFSIIGTQVALDMGHGAIIASV
CAVITGVFGGVLRDMMCNQIPLVFQKEIYAGVSFASAWVYIGLQYFSLPHNLVVIITLLI
GFTARLIALRFRLGLPVFNYPHSDH