Protein Info for EX31_RS15325 in Rahnella sp. WP5

Annotation: nitrogenase molybdenum-iron protein subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 PF11844: DUF3364" amino acids 1 to 55 (55 residues), 72.7 bits, see alignment 2.3e-24 TIGR01286: nitrogenase molybdenum-iron protein beta chain" amino acids 10 to 522 (513 residues), 806.7 bits, see alignment E=3.7e-247 PF00148: Oxidored_nitro" amino acids 69 to 500 (432 residues), 410.3 bits, see alignment E=8.1e-127

Best Hits

Swiss-Prot: 82% identical to NIFK_KLEPN: Nitrogenase molybdenum-iron protein beta chain (nifK) from Klebsiella pneumoniae

KEGG orthology group: K02591, nitrogenase molybdenum-iron protein beta chain [EC: 1.18.6.1] (inferred from 85% identity to dda:Dd703_0493)

MetaCyc: 82% identical to [FeMo]-nitrogenase complex dinitrogenase component beta subunit (Klebsiella pneumoniae)

Predicted SEED Role

"Nitrogenase (molybdenum-iron) beta chain (EC 1.18.6.1)" in subsystem Nitrogen fixation (EC 1.18.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>EX31_RS15325 nitrogenase molybdenum-iron protein subunit beta (Rahnella sp. WP5)
MSQDLGTPKSCFPLFEQDEYQSMFTNKRALEEAHGEAKVREVFEWTTTQEYQDLNFSREA
LTVDPAKACQPLGAVLCALGFANTLPYVHGSQGCVAYFRTYFNRHFKEPVACVSDSMTED
AAVFGGNNNMNVGLENASALYKPEIIAVSTTCMAEVIGDDLQAFIANAKKDGFVDAGMPI
PYAHTPSFLGSHVTGWDNMFEGFARTFTTDATREYQPGKLAKLNVVTGFETYLGNYRVIH
RMMSQMGVECSVLSDPSEVLDTPADGHYRMYAGGTTQTEMRDAPDAIDTLLLQPWQLQKT
KKVVQGDWNQPGTEVSVPIGLAATDALLMTVSELTGKPIADALATERGRLVDMMLDSHTW
LHGNRFGLYGDPDFVMGMTAFLLELGCEPTTILSHNGNKRWQKAMKKMLADSPYGQDSDV
YVNCDLWHFRSLMFTRKPDFMIGNSYGKFIQRDTLAKGEQFEVPLIRIGFPIFDRHHLHR
QTTWGYEGAMSILTQLVNAVLEQRDRETMKLGKTDYNFDLIR