Protein Info for EX31_RS15220 in Rahnella sp. WP5

Annotation: homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 66 (28 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 163.9 bits, see alignment E=1.7e-52

Best Hits

Swiss-Prot: 78% identical to RHTB_SHIFL: Homoserine/homoserine lactone efflux protein (rhtB) from Shigella flexneri

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 99% identity to rah:Rahaq_4231)

MetaCyc: 78% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>EX31_RS15220 homoserine/homoserine lactone efflux protein (Rahnella sp. WP5)
MTLDWWLTYLLTTSILSLSPGSGAINTMSTGISHGYRGAVASIAGLQLGLSIHIVLVGIG
LGALISSSLMAFEILKWLGAAYLIWLGICQWRSAGAIDLSALASSMPRRRLFKRAILVNL
TNPKSIVFLAALFPQFIIAHQPQAAQYVVLGVTTVVVDIIVMIGYATLATRIAGWVKAPK
QMQLLNRIFGSLFMLVGVLLASARKV