Protein Info for EX31_RS15195 in Rahnella sp. WP5

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 261 (254 residues), 320.8 bits, see alignment E=3.2e-100 PF00892: EamA" amino acids 9 to 142 (134 residues), 55.1 bits, see alignment E=4.7e-19 amino acids 153 to 283 (131 residues), 33.6 bits, see alignment E=2e-12

Best Hits

Swiss-Prot: 70% identical to RARD_SALTI: Protein RarD (rarD) from Salmonella typhi

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to rah:Rahaq_4237)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>EX31_RS15195 EamA family transporter RarD (Rahnella sp. WP5)
MDAHRTRQGVIFAFIAYLIWGIAPAYFKLIKQVPADEILTHRVIWSFFFMLVLLSVSRSW
GDVRRVLAQPKKIGMLLITALLVGGNWLIFIWAINHNHILEASLGYFINPLVNVVLGMLF
LRERFRSLQWFAVALAFAGVLVQVWVFGSVPVIAIGLSLTFAFYGLLRKKIGVDSQTGML
IETLWLLPVAGIYLFFIAHSQTSNLAANPWSLDLLLMAAGIITTIPLLFFTAAAARLKLS
TLGFFQYLGPTLMFLLAVVFYGETVNTSQLITFGFIWVGLLCFIGDALYTQGRLRRGRSG
HSAA