Protein Info for EX31_RS15055 in Rahnella sp. WP5

Annotation: UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 73 to 89 (17 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details TIGR02380: undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase" amino acids 8 to 351 (344 residues), 542.4 bits, see alignment E=2.2e-167 PF00953: Glycos_transf_4" amino acids 76 to 233 (158 residues), 104.7 bits, see alignment E=2.5e-34

Best Hits

Swiss-Prot: 82% identical to WECA_YERPE: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (wecA) from Yersinia pestis

KEGG orthology group: K02851, undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase [EC: 2.7.8.-] (inferred from 100% identity to rah:Rahaq_4262)

MetaCyc: 77% identical to UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Escherichia coli O157)
GLCNACPTRANS-RXN [EC: 2.7.8.33]

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-, 2.7.8.33

Use Curated BLAST to search for 2.7.8.- or 2.7.8.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>EX31_RS15055 UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Rahnella sp. WP5)
MNLLNMSTELAVVFVFSFLFLFVARKVANKIGLVDKPNFRKRHQGLIPLVGGISVFAGVC
FAFLITSYTIPHGYLYLACAGLLVLVGGLDDRFDISVKTRAMVQAVVAVAMMSFANLTLR
SLGHLIGPWEMVLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSCVSFGSLGIIMYDS
GHMELAFWCFAMIAAIIPYILLNLGVLGPRYKVFMGDAGSTLIGFTVIWILLQSTQGESH
PMNPVTALWLIAIPLMDMVAIMYRRLRKGMSPFSADRQHIHHLIMRAGFTSRQAFVLITV
AAAILAGIGVVGEHLSFVPEWIMLALFFVAFLVYGICIKHAWRVARFIKRVKRRLRRSSN
Q