Protein Info for EX31_RS14835 in Rahnella sp. WP5

Annotation: 16S rRNA (guanine(966)-N(2))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 1 to 190 (190 residues), 230.2 bits, see alignment E=8.1e-73 PF03602: Cons_hypoth95" amino acids 13 to 188 (176 residues), 215.2 bits, see alignment E=6e-68 PF05175: MTS" amino acids 48 to 137 (90 residues), 24.4 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 71% identical to RSMD_ECOLI: Ribosomal RNA small subunit methyltransferase D (rsmD) from Escherichia coli (strain K12)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 100% identity to rah:Rahaq_4199)

MetaCyc: 71% identical to 16S rRNA m2G966 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6515 [EC: 2.1.1.171]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>EX31_RS14835 16S rRNA (guanine(966)-N(2))-methyltransferase (Rahnella sp. WP5)
MAKKPNTPAAGQIRIIGGQWRGRKLPVPHSPGLRPTTDRVRETLFNWLAPVLQGAHCLDC
FAGSGALGLEALSRYAASATLLEFERPVAQQLEKNLALLNASDAKVFNVNALNWLAKAGS
AFDVVFLDPPFRKGILQDTLNLLEQNQWLADEAWIYVETEAEHDTLDVPARWRLHREKVA
GQVAYRLYHRDVTPETGSPEQE