Protein Info for EX31_RS14750 in Rahnella sp. WP5

Annotation: sn-glycerol-3-phosphate ABC transporter permease UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 276 (183 residues), 76.3 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 87% identical to UGPE_YERE8: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to rah:Rahaq_4182)

MetaCyc: 77% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>EX31_RS14750 sn-glycerol-3-phosphate ABC transporter permease UgpE (Rahnella sp. WP5)
MIENRRGLDIFSHIMLLLGVLVILFPLYVAFVAASLDNKQIFDVPMTLIPGTHLWENITT
IWTQGAGNSSPAFGRMLINSFIMAMVITVGKISVSMLSAYAIVYFRFPLRNLFFWLIFMT
LMLPVEVRIFPTVQVIANLHMLDSYTGLTLPLMASATATFLFRQFFMTLPDELLEAARID
GAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILITSDVSMGTAVAGIKSMISS
GDGSTQWNQVMAAMILTLLPPLAVVLLMQRWFVRGLVDSEK