Protein Info for EX31_RS14635 in Rahnella sp. WP5

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 20 to 53 (34 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details PF09335: VTT_dom" amino acids 41 to 165 (125 residues), 61 bits, see alignment E=8e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4163)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>EX31_RS14635 DedA family protein (Rahnella sp. WP5)
MTVHDLLEYTTTFIRAHQVWAAPIVFFLAFGESLAFLSLLLPATFILLGLGALIGETGIP
FWPIWAAAAAGAFLGDWLSYWIGARYQDRVGNFWPFSRHPQMLVRGHAFFEKWGMPGAFI
GRFFGPLRAVVPLVAGICGMPQKYFQIANVTSALIWAFGILAPGAFGIQWLSRWF