Protein Info for EX31_RS14435 in Rahnella sp. WP5

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF13439: Glyco_transf_4" amino acids 23 to 188 (166 residues), 68.1 bits, see alignment E=2e-22 PF00534: Glycos_transf_1" amino acids 205 to 359 (155 residues), 99.9 bits, see alignment E=2.4e-32 PF13692: Glyco_trans_1_4" amino acids 214 to 341 (128 residues), 80.1 bits, see alignment E=4e-26 PF13524: Glyco_trans_1_2" amino acids 291 to 361 (71 residues), 26.8 bits, see alignment E=9.7e-10

Best Hits

KEGG orthology group: K02844, UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to rah:Rahaq_4349)

Predicted SEED Role

"UDP-glucose:(heptosyl) LPS alpha1,3-glucosyltransferase WaaG (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>EX31_RS14435 glycosyltransferase family 4 protein (Rahnella sp. WP5)
MTNAASGKNIRLAIVRQKYRPDGGAERFISRALEALDDQNIDLNIITRQWEGKPNPQWKI
HLCNPAKYGRVSREKGFAAAAQQCWKQEHFDIVQSHERIPGCDIFRAGDGAHRVWLEQRA
RVISPLQRFLTKISPYHRYVLQAEEEMFHSPALKKIICNSEMVKRDIIRCYGVDESRFEV
IYNAIDSQKFVPATDAQRLAAREMLSIPAQAVALIYVGSGFERKGLKPAIEAIACGDRYL
IVVGQDKDQKKYESLAKQSGCADRVRFVGVQNNVLPYYHAADGMILPTLYDPFPNVILEA
MACGLPVITSETCGGAEFILQGREGFVCDALDVIRLSEYVNKIPSRQENDQMGNAARERI
LPYSPKNLSKQLVTLYHSLLV