Protein Info for EX31_RS14425 in Rahnella sp. WP5

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF13641: Glyco_tranf_2_3" amino acids 12 to 125 (114 residues), 50.8 bits, see alignment E=3.1e-17 PF10111: Glyco_tranf_2_2" amino acids 13 to 116 (104 residues), 36.2 bits, see alignment E=7.6e-13 PF00535: Glycos_transf_2" amino acids 13 to 138 (126 residues), 124.4 bits, see alignment E=6.8e-40

Best Hits

Swiss-Prot: 54% identical to YIBD_ECOLI: Uncharacterized glycosyltransferase YibD (yibD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_4347)

MetaCyc: 54% identical to UDP-glucuronate:LPS(HepIII) glycosyltransferase (Escherichia coli K-12 substr. MG1655)
Glucuronosyltransferase. [EC: 2.4.1.17]

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>EX31_RS14425 glycosyltransferase (Rahnella sp. WP5)
MPLTTTSDNIKLSAIIPLYNAGEMFRNFMDSLVAQTLTNFEIIIVNDGSTDGSECVAQEY
AEKYPHIRVIHQANGGVSRARNAGLDIAKGQYVTFPDADDILYPNMYQTLIELCEQDDLD
VAQCNGERYFVGSEKVKPIIPTDRLTSTAVLDGPHWLKMALATNRYLHVVWLGVYRLELI
KKHHLYFEPGLHHQDIPWTTEFMFNARRVKYTQEVLYRYYIHGQSISNQKRTGMKNVEYQ
RHYLKIAKMLDELNERYKGQVKIYAEFPRQVTREALTVCHSVRREPVQAAQKAIIDDIYT
SGTRRIMLRNARGPKQWWQLLLWLYRLHNLRKKLG