Protein Info for EX31_RS14285 in Rahnella sp. WP5

Annotation: ferredoxin--NADP(+) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00970: FAD_binding_6" amino acids 20 to 90 (71 residues), 31.9 bits, see alignment E=1.4e-11 PF00175: NAD_binding_1" amino acids 111 to 222 (112 residues), 63.2 bits, see alignment E=3.5e-21

Best Hits

Swiss-Prot: 76% identical to FENR_SHIFL: Flavodoxin/ferredoxin--NADP reductase (fpr) from Shigella flexneri

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 98% identity to rah:Rahaq_4319)

MetaCyc: 76% identical to flavodoxin/ferredoxin-NADP+ reductase (Escherichia coli K-12 substr. MG1655)
FLAVONADPREDUCT-RXN [EC: 1.19.1.1]

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.2 or 1.19.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>EX31_RS14285 ferredoxin--NADP(+) reductase (Rahnella sp. WP5)
MADWVTGKVKKVEHWTDNLFSITVNAPIDPFTAGQFAKLSLDIDGERVQRAYSYVNPPSS
GELEFYLVNVPEGKLSPRLHVMQPGDEINITKEAAGFFVIEEVPECDTLWMLATGTAIGP
YLSILQEGQGLERFKNIVLVHAARFAADLSYLPLMQQLQRRYEGKLHIQTVVSREEISGS
LTGRVPALIESGALEAAVGLKMLAEDSHVMLCGNPQMVRDTQQVLKDTRGMRKHLKRKPG
HMTSEHYW