Protein Info for EX31_RS14005 in Rahnella sp. WP5
Annotation: 4-deoxy-4-formamido-L-arabinose- phosphoundecaprenol deformylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to ARND_PROMH: Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (arnD) from Proteus mirabilis (strain HI4320)
KEGG orthology group: K13014, undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC: 3.5.-.-] (inferred from 100% identity to rah:Rahaq_2820)Predicted SEED Role
"Polymyxin resistance protein PmrJ, predicted deacetylase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )
Isozymes
Compare fitness of predicted isozymes for: 3.5.-.-
Use Curated BLAST to search for 3.5.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (299 amino acids)
>EX31_RS14005 4-deoxy-4-formamido-L-arabinose- phosphoundecaprenol deformylase (Rahnella sp. WP5) MKKVGLRIDVDTWSGTREGVPQLLQTLANHKITASFFFSVGPDNMGRHLWRLLKPRFLWK MLRSNAASLYGWDILLAGTAWPGKLIARDLGYLMKETAKRGHEVGLHAWDHQGWQAKVGK WSEKQLEEQIRLGLDALEKSLGHDVECSAVAGWRADERVIEVKERFHFYYNSDCRGTRPF LPVLENGTLGTVQIPVTLPTYDEVAGGEINADNFNDFILDAIAKDHGVPVYTIHAEVEGM SLAKQFDELLTRASAQGIQFCALGELLPQDLSTLPRGKVVRASFPGREGWLGCQQEGFS