Protein Info for EX31_RS14000 in Rahnella sp. WP5

Annotation: lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 166 to 198 (33 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details PF02366: PMT" amino acids 12 to 240 (229 residues), 130.5 bits, see alignment E=8.3e-42 PF13231: PMT_2" amino acids 64 to 225 (162 residues), 54.8 bits, see alignment E=1.4e-18

Best Hits

Swiss-Prot: 63% identical to ARNT_YERE8: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 100% identity to rah:Rahaq_2819)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>EX31_RS14000 lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase (Rahnella sp. WP5)
MSKTIKGLWGTLILVFFALVYLVPLNTRLLWQPDETRYAEISREMLQRGDWVVPHLLGLR
YFEKPVAGYWFNNISQMIFGDSNFAVRFGSVFSTALSAILVFWLAHLMWRNRQTAYTAAL
IYLSMTLVFGIGTYSVMDPMITLWMTAAMVASYFCLRVSRTPQKALSWIALGLACGMGFM
TKGFLALALPVIAVLPIIWREKRFKTLLGWGPLAIVSAAVLSLPWVLAIAHREPDFWNYF
FWVEHIQRFAEADAQHKAPFWYYLPVLFLGALPWLGLLPGALRAGWTQRVVRPELFFLLS
WAIMPLIFFSIAKGKLPTYILPCFAPLALLMADYLDKILESGKLRALKANGTLNIVFGVL
LAVAVLLISGILPFHIKAVFSRSELPHALIGILCFAVWALAGAVSLTDLKKRWYWAALCP
LVLALLAGQAIPKKVMDSKQPQPFLTQNMALLKDSRYVLTDNVGVATAVAWTLKRSDILM
FDEKGELQYGLSYPDAKDNFVDAAHFSQWLQQARQAGNVSLILRLDRNAAVKSSLPPADQ
TVRIDRQALLFYKKLP