Protein Info for EX31_RS13960 in Rahnella sp. WP5

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF01032: FecCD" amino acids 8 to 317 (310 residues), 312.9 bits, see alignment E=1.1e-97

Best Hits

Swiss-Prot: 80% identical to HMUU_YERPE: Hemin transport system permease protein HmuU (hmuU) from Yersinia pestis

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to rah:Rahaq_2810)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>EX31_RS13960 iron ABC transporter permease (Rahnella sp. WP5)
MIGLGGALLVLAVMAANTGAMSLSLRTLLARPFGDSLWQVWLTIRLPRVLLAVVVGCALA
SSGAVMQGLFRNPLADPGLLGISSGAALAVALTIVMPLALPPLLALYSHMISAFAGSLAI
SAIVFTLSRFGHGGLSRLLLAGIAINALCGAAVGVLTYVSDDQQLRQFSLWSMGSLGQAQ
WPTLAVASSLILPACVAALFMARRLNILQLGEEDAHYLGVNVRRTQLQLLLLSALLVGAA
VAVSGVIGFIGLVIPHLLRMRIGADHRWLLPGSAMAGACLLLLADTLARTLVAPAEMPVG
LLTSLIGGPYFLWLILRPGVPRNV